Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4S2 Rabbit Polyclonal Antibody (HRP)

OR4S2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR4S2P, OST725, OR11-137

UniProt

Q8NH73

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4S2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGSHIAMV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sil CRISPR/Cas9 KO Plasmid (m)
sc-422948 20 µg

Sil CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
AKR1D1 Antibody - middle region
ARP60804_P050-25UL 25 µL

AKR1D1 Antibody - middle region

Sign In for Pricing
View Details
Human Placental growth factor (PLGF) ELISA Kit
YP-W11358-01 48 Tests

Human Placental growth factor (PLGF) ELISA Kit

Sign In for Pricing
View Details
Human Placental growth factor (PLGF) ELISA Kit
YP-W11358-02 96 Tests

Human Placental growth factor (PLGF) ELISA Kit

Sign In for Pricing
View Details
Bovine Vitamin H ELISA Kit
GTR10354972 96 Well

Bovine Vitamin H ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD45RO Antibody (190-2F2.5) [mFluor Violet 450 SE]
NBP2-47956MFV450 0.1 mL

Mouse Monoclonal CD45RO Antibody (190-2F2.5) [mFluor Violet 450 SE]

Sign In for Pricing
View Details