Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTKN2 Rabbit Polyclonal Antibody (FITC)

RTKN2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PLEKHK1, bA531F24.1

UniProt

Q8IZC4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RTKN2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Coiled Coil Domain Containing Protein 80 ELISA Kit
MBS097777 Inquire

Donkey Coiled Coil Domain Containing Protein 80 ELISA Kit

Sign In for Pricing
View Details
IFI30 (NM_006332) Human Over-expression Lysate
LC416719 20 µg

IFI30 (NM_006332) Human Over-expression Lysate

Sign In for Pricing
View Details
Prkch, ID (Prkch, Pkch, Protein kinase C eta type, PKC-L, nPKC-eta) (AP) discontinued
040450-AP 200 µL

Prkch, ID (Prkch, Pkch, Protein kinase C eta type, PKC-L, nPKC-eta) (AP) discontinued

Sign In for Pricing
View Details
DES Antibody
E308457 200 µL

DES Antibody

Sign In for Pricing
View Details
PPDPF Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV694613 1.0 µg DNA

PPDPF Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
EMG1 Rabbit Polyclonal Antibody (APC)
orb1003572 100 µL

EMG1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details