Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMIM29 Rabbit Polyclonal Antibody (Biotin)

SMIM29 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LBH, C6orf1

UniProt

Q86T20

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C6orf1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_001008704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma C Crystallin Rabbit Polyclonal Antibody (BF647)
orb2526192 100 µL

Gamma C Crystallin Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Recombinant Human SYP/Synaptophysin Protein, N-GST & C-His
AP97608 50 µg

Recombinant Human SYP/Synaptophysin Protein, N-GST & C-His

Sign In for Pricing
View Details
Duck G Protein Alpha Inhibiting Activity Polypeptide 3 ELISA Kit
MBS066053 Inquire

Duck G Protein Alpha Inhibiting Activity Polypeptide 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal GLIS3 Antibody (PCRP-GLIS3-1B11) [HRP]
NBP3-14052H 0.1 mL

Mouse Monoclonal GLIS3 Antibody (PCRP-GLIS3-1B11) [HRP]

Sign In for Pricing
View Details
PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (MaxLight 405)
MBS6191984-01 0.1 mL

PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (MaxLight 405)

Sign In for Pricing
View Details
PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (MaxLight 405)
MBS6191984-02 5x 0.1 mL

PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (MaxLight 405)

Sign In for Pricing
View Details