Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCZ1B Rabbit Polyclonal Antibody (FITC)

CCZ1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CCZ1, C7orf28A, C7orf28B, H_NH0577018.2

UniProt

P86790

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCZ1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_932765

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF405S conjugate, 0.1mg/mL
BNC043779-100 1x 100 µL

MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]
AM31226PU-N 2 mL (200 Tests)

CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]

Sign In for Pricing
View Details
Syntaxin 18 (STX18) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]
TA809386BM 100 µL

Syntaxin 18 (STX18) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]

Sign In for Pricing
View Details
Human D-amino Acid Oxidase Activator (DAOA) ELISA Kit
RDR-DAOA-Hu-01 96 Tests

Human D-amino Acid Oxidase Activator (DAOA) ELISA Kit

Sign In for Pricing
View Details
Human D-amino Acid Oxidase Activator (DAOA) ELISA Kit
RDR-DAOA-Hu-02 48 Tests

Human D-amino Acid Oxidase Activator (DAOA) ELISA Kit

Sign In for Pricing
View Details
CD68 Antibody
F45597-0.4ML 0.4 mL

CD68 Antibody

Sign In for Pricing
View Details