Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VXN Rabbit Polyclonal Antibody (HRP)

VXN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C8orf46

UniProt

Q8TAG6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C8orf46

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATN

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse DDR1 Kinase/MCK10 Protein (His &GST Tag)
PKSM040294 50 µg

Recombinant Mouse DDR1 Kinase/MCK10 Protein (His &GST Tag)

Sign In for Pricing
View Details
STK35 Polyclonal Antibody, HRP Conjugated
bs-12834R-HRP 100 µL

STK35 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Chicken Peroxisome Proliferator Activated Receptor Delta (PPARd) ELISA Kit
abx355654 96 Well

Chicken Peroxisome Proliferator Activated Receptor Delta (PPARd) ELISA Kit

Sign In for Pricing
View Details
Eosinophil Peroxidase (Eosinophil peroxidase heavy chain, EPER, EPO, EPP, EPX, EPX PEN, PERE) (BSA & Azide Free) (MaxLight 405)
MBS6193771-01 0.1 mL

Eosinophil Peroxidase (Eosinophil peroxidase heavy chain, EPER, EPO, EPP, EPX, EPX PEN, PERE) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
Eosinophil Peroxidase (Eosinophil peroxidase heavy chain, EPER, EPO, EPP, EPX, EPX PEN, PERE) (BSA & Azide Free) (MaxLight 405)
MBS6193771-02 5x 0.1 mL

Eosinophil Peroxidase (Eosinophil peroxidase heavy chain, EPER, EPO, EPP, EPX, EPX PEN, PERE) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
Calpain 2 Antibody
R12-2051-01 50 μL

Calpain 2 Antibody

Sign In for Pricing
View Details