Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDRT15L2 Rabbit Polyclonal Antibody (FITC)

CDRT15L2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

A8MXV6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDRT15L2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLIPHPRRLWPFVRRRTQVPQDSPGQALAGQATPEIPSGLPLHIVLVQEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001177719

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL2A1 (Collagen alpha-1 (II) Chain, Alpha-1 Type II collagen, Collagen alpha-1 (II) Chain, Chondrocalcin, COL2A1, CollagenII, Collagen II, Collagen-II, Collagen-2, Collagen2, Collagen 2) discontinued
221799-01 50 µL

COL2A1 (Collagen alpha-1 (II) Chain, Alpha-1 Type II collagen, Collagen alpha-1 (II) Chain, Chondrocalcin, COL2A1, CollagenII, Collagen II, Collagen-II, Collagen-2, Collagen2, Collagen 2) discontinued

Sign In for Pricing
View Details
COL2A1 (Collagen alpha-1 (II) Chain, Alpha-1 Type II collagen, Collagen alpha-1 (II) Chain, Chondrocalcin, COL2A1, CollagenII, Collagen II, Collagen-II, Collagen-2, Collagen2, Collagen 2) discontinued
221799-02 100 µL

COL2A1 (Collagen alpha-1 (II) Chain, Alpha-1 Type II collagen, Collagen alpha-1 (II) Chain, Chondrocalcin, COL2A1, CollagenII, Collagen II, Collagen-II, Collagen-2, Collagen2, Collagen 2) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Peripheral myelin protein 22 (Pmp22)
MBS7026815-01 0.02 mg

Recombinant Mouse Peripheral myelin protein 22 (Pmp22)

Sign In for Pricing
View Details
Recombinant Mouse Peripheral myelin protein 22 (Pmp22)
MBS7026815-02 0.1 mg

Recombinant Mouse Peripheral myelin protein 22 (Pmp22)

Sign In for Pricing
View Details
Recombinant Mouse Peripheral myelin protein 22 (Pmp22)
MBS7026815-03 5x 0.1 mg

Recombinant Mouse Peripheral myelin protein 22 (Pmp22)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: left
CS642411 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details