Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51B5 Rabbit Polyclonal Antibody (HRP)

OR51B5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-37, HOR5'Beta5

UniProt

Q9H339

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51B5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCVSHICCV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IsoPure™ 96, Automated Purification System, 230V
AP1096-E 1 Each

IsoPure™ 96, Automated Purification System, 230V

Sign In for Pricing
View Details
Recombinant Mouse CCL25/TECK Protein (Trx Tag)
PDEM100182-01 20 µg

Recombinant Mouse CCL25/TECK Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL25/TECK Protein (Trx Tag)
PDEM100182-02 100 µg

Recombinant Mouse CCL25/TECK Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL25/TECK Protein (Trx Tag)
PDEM100182-03 500 µg

Recombinant Mouse CCL25/TECK Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL25/TECK Protein (Trx Tag)
PDEM100182-04 1 mg

Recombinant Mouse CCL25/TECK Protein (Trx Tag)

Sign In for Pricing
View Details
SMAD5 Human Gene Knockout Kit (CRISPR)
KN401949 1 Kit

SMAD5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details