Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRYD4 Rabbit Polyclonal Antibody (Biotin)

SPRYD4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8WW59

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPRYD4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDMGVKYGLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADAM19 Pre-designed siRNA Set A
SI000257A 1 Each

Human ADAM19 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2 (nuoK2)
orb2933859-01 20 µg

Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Sign In for Pricing
View Details
Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2 (nuoK2)
orb2933859-02 100 µg

Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Sign In for Pricing
View Details
JMY, NT (JMY, Junction-mediating and -regulatory protein)
037210 200 µL

JMY, NT (JMY, Junction-mediating and -regulatory protein)

Sign In for Pricing
View Details
Rabbit anti-human Dynein heavy chain 3, axonemal polyclonal Antibody(DNAH3), Biotin conjugated
MBS1498585-01 0.05 mg

Rabbit anti-human Dynein heavy chain 3, axonemal polyclonal Antibody(DNAH3), Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Dynein heavy chain 3, axonemal polyclonal Antibody(DNAH3), Biotin conjugated
MBS1498585-02 0.1 mg

Rabbit anti-human Dynein heavy chain 3, axonemal polyclonal Antibody(DNAH3), Biotin conjugated

Sign In for Pricing
View Details