Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIAH3 Rabbit Polyclonal Antibody (Biotin)

SIAH3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8IW03

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIAH3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_942146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wee 2 Lentiviral Activation Particles (m2)
sc-436324-LAC-2 200 µL

Wee 2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
TRIT1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2470903 1.0 µg DNA

TRIT1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)
MBS2116252-01 0.1 mL

HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)
MBS2116252-02 0.2 mL

HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)
MBS2116252-03 0.5 mL

HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)
MBS2116252-04 1 mL

HRP-Linked Polyclonal Antibody to Calcyon Neuron Specific Vesicular Protein (CALY)

Sign In for Pricing
View Details