Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIAH3 Rabbit Polyclonal Antibody (HRP)

SIAH3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IW03

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIAH3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_942146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3711407 1.0 µg DNA

Kcnc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ARL14 Human shRNA Plasmid Kit (Locus ID 80117)
TL306594 1 Kit

ARL14 Human shRNA Plasmid Kit (Locus ID 80117)

Sign In for Pricing
View Details
PTPN12-set siRNA/shRNA/RNAi Lentivector (Human)
38148091 4x 500 ng

PTPN12-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
COL2A1 Rabbit Polyclonal Antibody
AF6528 50 µL

COL2A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse E3 ubiquitin-protein ligase HECTD3 (HECTD3) ELISA Kit
abx526958 96 Tests

Mouse E3 ubiquitin-protein ligase HECTD3 (HECTD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-1/CD169 Antibody (HSn 7D2) [FITC]
NB600-534F 0.1 mL

Mouse Monoclonal Siglec-1/CD169 Antibody (HSn 7D2) [FITC]

Sign In for Pricing
View Details