Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERB1 Rabbit Polyclonal Antibody (HRP)

TERB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCDC79

UniProt

Q8NA31

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC79

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISIQNTWKHLHADRIGRGSKAEDEDKSHSRQLQSYKSHGVMSKACTNDDQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001129977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep anti Rat IgG Fab
ShARa/Fab/7S 10 mg

Sheep anti Rat IgG Fab

Sign In for Pricing
View Details
3-Hydroxy-2,2,4-trimethylvaleric Acid Ethyl Ester
425945-01 50 mg

3-Hydroxy-2,2,4-trimethylvaleric Acid Ethyl Ester

Sign In for Pricing
View Details
3-Hydroxy-2,2,4-trimethylvaleric Acid Ethyl Ester
425945-02 500 mg

3-Hydroxy-2,2,4-trimethylvaleric Acid Ethyl Ester

Sign In for Pricing
View Details
Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (APC) discontinued
S1013-57E2-APC 100 µL

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (APC) discontinued

Sign In for Pricing
View Details
Alkal2 Mouse siRNA Oligo Duplex (Locus ID 100294583)
SR403151 1 Kit

Alkal2 Mouse siRNA Oligo Duplex (Locus ID 100294583)

Sign In for Pricing
View Details
Mouse Monoclonal Bassoon Antibody (SAP7F407) [Alexa Fluor 350]
NB120-13249AF350 0.2 mL

Mouse Monoclonal Bassoon Antibody (SAP7F407) [Alexa Fluor 350]

Sign In for Pricing
View Details