Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERB1 Rabbit Polyclonal Antibody (Biotin)

TERB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCDC79

UniProt

Q8NA31

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC79

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ANPVHACYRESEQNKTLYKAKSSCNQNLHEETTFEKNFVSQSSDHVFKHP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammaglobin B Rabbit Polyclonal Antibody (BF350)
orb2427122 100 µL

Mammaglobin B Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
RTP1 Double Nickase Plasmid (h2)
sc-414387-NIC-2 20 µg

RTP1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ITIH2, CT (Inter-alpha-Trypsin Inhibitor Heavy Chain H2, Inter-alpha-Inhibitor Heavy Chain 2, ITI Heavy Chain H2, ITI-HC2, H2P, IGHEP2, Inter-alpha-Trypsin Inhibitor Complex Component II, Serum-derived Hyaluronan-associated Protein, SHAP) (MaxLight 750)
MBS6483676-01 0.1 mL

ITIH2, CT (Inter-alpha-Trypsin Inhibitor Heavy Chain H2, Inter-alpha-Inhibitor Heavy Chain 2, ITI Heavy Chain H2, ITI-HC2, H2P, IGHEP2, Inter-alpha-Trypsin Inhibitor Complex Component II, Serum-derived Hyaluronan-associated Protein, SHAP) (MaxLight 750)

Sign In for Pricing
View Details
ITIH2, CT (Inter-alpha-Trypsin Inhibitor Heavy Chain H2, Inter-alpha-Inhibitor Heavy Chain 2, ITI Heavy Chain H2, ITI-HC2, H2P, IGHEP2, Inter-alpha-Trypsin Inhibitor Complex Component II, Serum-derived Hyaluronan-associated Protein, SHAP) (MaxLight 750)
MBS6483676-02 5x 0.1 mL

ITIH2, CT (Inter-alpha-Trypsin Inhibitor Heavy Chain H2, Inter-alpha-Inhibitor Heavy Chain 2, ITI Heavy Chain H2, ITI-HC2, H2P, IGHEP2, Inter-alpha-Trypsin Inhibitor Complex Component II, Serum-derived Hyaluronan-associated Protein, SHAP) (MaxLight 750)

Sign In for Pricing
View Details
Anti-Mouse RNF8 (KIAA0646), Rabbit Polyclonal
MKA0646PA Inquire

Anti-Mouse RNF8 (KIAA0646), Rabbit Polyclonal

Sign In for Pricing
View Details
BCORL1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0177602 1.0 µg DNA

BCORL1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details