Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf91 Rabbit Polyclonal Antibody (FITC)

C16orf91 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

URLC5, gs103, CCSMST1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C16orf91

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DCPGYACVLSTEGLGWWMGHLAMLIRVKAEQNLSRSETAPRLALDVQGFH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001010878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUOX rabbit pAb
E44H12895 100 µL

SUOX rabbit pAb

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum rplP Protein (aa 1-147) (strain Kyoto / Type A2)
VAng-Lsx8559-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Botulinum rplP Protein (aa 1-147) (strain Kyoto / Type A2)

Sign In for Pricing
View Details
Human Asialoglycoprotein Receptor 1 (ASGR1) ELISA Kit
orb775540-01 48 Tests

Human Asialoglycoprotein Receptor 1 (ASGR1) ELISA Kit

Sign In for Pricing
View Details
Human Asialoglycoprotein Receptor 1 (ASGR1) ELISA Kit
orb775540-02 96 Tests

Human Asialoglycoprotein Receptor 1 (ASGR1) ELISA Kit

Sign In for Pricing
View Details
SUSD2 Rabbit Polyclonal Antibody (Cy5.5)
orb1078532 100 µL

SUSD2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS704152 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details