Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf91 Rabbit Polyclonal Antibody (HRP)

C16orf91 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URLC5, gs103, CCSMST1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C16orf91

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DCPGYACVLSTEGLGWWMGHLAMLIRVKAEQNLSRSETAPRLALDVQGFH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001010878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTP binding protein era homolog (ERAL1) (NM_005702) Human Over-expression Lysate
LC401739 20 µg

GTP binding protein era homolog (ERAL1) (NM_005702) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS709793 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Human RPAP3 activation kit by CRISPRa
GA112524 1 Kit

Human RPAP3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Prkacb activation kit by CRISPRa
GA203240 1 Kit

Mouse Prkacb activation kit by CRISPRa

Sign In for Pricing
View Details
PARVB (NM_001003828) Human Over-expression Lysate
LY424026 100 µg

PARVB (NM_001003828) Human Over-expression Lysate

Sign In for Pricing
View Details
GADD45A (NM_001924) Human Recombinant Protein
TP720561 10 µg

GADD45A (NM_001924) Human Recombinant Protein

Sign In for Pricing
View Details