Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METRNL Rabbit Polyclonal Antibody (HRP)

METRNL Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q641Q3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human METRNL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLLLLAGLLGGAGAQYSSDRCSWKGSGLTHEAHRKEVEQVYLRCAAGAVE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TET3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15H3]
TA803981AM 100 µL

TET3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15H3]

Sign In for Pricing
View Details
FAM-LEHD-FMK Caspase 9 Detection Kit
FAM400-1 25 Tests

FAM-LEHD-FMK Caspase 9 Detection Kit

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF405S conjugate, 0.1mg/mL
BNC043340-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMA7 / HSPC Recombinant Rabbit monoclonal Antibody
HA751504 100 µL

PSMA7 / HSPC Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CTXN1 (NM_206833) Human Over-expression Lysate
LC404233 20 µg

CTXN1 (NM_206833) Human Over-expression Lysate

Sign In for Pricing
View Details
8-13C-Uric Acid (contains ~1.5% unlabelled)
TRC-U829202-1MG 1 mg

8-13C-Uric Acid (contains ~1.5% unlabelled)

Sign In for Pricing
View Details