Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35F4 Rabbit Polyclonal Antibody (Biotin)

SLC35F4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C14orf36, c14_5373

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35F4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLMLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001193849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Htra4 Rat Pre-designed siRNA Set A
HY-RS29083 1 Set

Htra4 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae malP Protein (aa 1-108)
VAng-Cr5059-1mgEcoli 1 mg (E. coli)

Recombinant Klebsiella Pneumoniae malP Protein (aa 1-108)

Sign In for Pricing
View Details
HCV Core protein Polyclonal Antibody, Cy3 Conjugated
bs-0221R-Cy3 100 µL

HCV Core protein Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-01 0.1 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-02 0.2 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-03 0.5 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Sign In for Pricing
View Details