Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35F4 Rabbit Polyclonal Antibody (HRP)

SLC35F4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C14orf36, c14_5373

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35F4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLMLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001193849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ECM1 (Extracellular matrix protein 1) ELISA Kit
EKF57409 96 Tests

Human ECM1 (Extracellular matrix protein 1) ELISA Kit

Sign In for Pricing
View Details
Wrb 3'UTR GFP Stable Cell Line
TU273441 1.0 mL

Wrb 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti Mouse CD22 Flow Cytometry Monoclonal Clone CY341 AF647 Ready To Use 100 Tests
IMSAMSCD22CY341CAF647100 100 Tests

Anti Mouse CD22 Flow Cytometry Monoclonal Clone CY341 AF647 Ready To Use 100 Tests

Sign In for Pricing
View Details
Lupeol acetate
N2847-5 5 mg

Lupeol acetate

Sign In for Pricing
View Details
Monoclonal Anti-Influenza A (A/Hong Kong/483/1997) HA (H5N1) Antibody, Human IgG1 (6A2) (MALS verified)
HA1-MY2161-1mg 1 mg

Monoclonal Anti-Influenza A (A/Hong Kong/483/1997) HA (H5N1) Antibody, Human IgG1 (6A2) (MALS verified)

Sign In for Pricing
View Details