Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35F4 Rabbit Polyclonal Antibody (HRP)

SLC35F4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C14orf36, c14_5373

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35F4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLMLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001193849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGK-IN-8
HY-164905 1 Each

DGK-IN-8

Sign In for Pricing
View Details
FBXL19, CT (FBXL19, FBL19, F-box/LRR-repeat protein 19, F-box and leucine-rich repeat protein 19) (MaxLight 750) discontinued
035543-ML750 100 µL

FBXL19, CT (FBXL19, FBL19, F-box/LRR-repeat protein 19, F-box and leucine-rich repeat protein 19) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse MPP7 shRNA Plasmid
abx978487-01 150 µg

Mouse MPP7 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MPP7 shRNA Plasmid
abx978487-02 300 µg

Mouse MPP7 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Zfx activation kit by CRISPRa
GA204733 1 Kit

Mouse Zfx activation kit by CRISPRa

Sign In for Pricing
View Details
Trim55 ORF Vector (Rat) (pORF)
ORF078248 1.0 µg DNA

Trim55 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details