Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAC2 Rabbit Polyclonal Antibody (Biotin)

STAC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

24b2, 24b2/STAC2

UniProt

Q6ZMT1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_945344

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Irf2bpl shRNA (UAS) - Lentiviral mouse Irf2bpl shRNA (UAS) (100)
GTR15139638 1 Vial

Lentiviral mouse Irf2bpl shRNA (UAS) - Lentiviral mouse Irf2bpl shRNA (UAS) (100)

Sign In for Pricing
View Details
MITD1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2474759 100 µL

MITD1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Rock Fall Activ-Step Anti-Fatigue Footbed - Size 11
SAF3422 PR

Rock Fall Activ-Step Anti-Fatigue Footbed - Size 11

Sign In for Pricing
View Details
GPR146, ID (GPR146, PGR8, Probable G-protein coupled receptor 146, G-protein coupled receptor PGR8)
036224 200 µL

GPR146, ID (GPR146, PGR8, Probable G-protein coupled receptor 146, G-protein coupled receptor PGR8)

Sign In for Pricing
View Details
UgpE Antibody
orb834256 2 mg

UgpE Antibody

Sign In for Pricing
View Details
Mouse Izumo1 qPCR Primer Pair
QM42058S 200 Tests

Mouse Izumo1 qPCR Primer Pair

Sign In for Pricing
View Details