Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAC2 Rabbit Polyclonal Antibody (Biotin)

STAC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

24b2, 24b2/STAC2

UniProt

Q6ZMT1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_945344

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hanna Nitrite Reagent High
WAT1493 1 Each

Hanna Nitrite Reagent High

Sign In for Pricing
View Details
3-[2- (dimethylamino) -2-oxoethyl]-2- (4-methylphenyl) imidazo[1,2-a]pyridine-6-carboxylic acid
JH610319 1 Each

3-[2- (dimethylamino) -2-oxoethyl]-2- (4-methylphenyl) imidazo[1,2-a]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
hsa-miR-518f-3p miRNA Inhibitor
MIH02895 2x 5.0 nmol

hsa-miR-518f-3p miRNA Inhibitor

Sign In for Pricing
View Details
Caprine Insulin (INS) ELISA Kit-Competitive
EK8F483 96 Tests

Caprine Insulin (INS) ELISA Kit-Competitive

Sign In for Pricing
View Details
Anti-Mycobacterium tuberculosis sodB Antibody (SAA2171)
RXX19101 100 μg

Anti-Mycobacterium tuberculosis sodB Antibody (SAA2171)

Sign In for Pricing
View Details
KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K(VCA)beta-4, Maxi K Channel Subunit beta-4, Sl
MBS6383465-01 0.1 mL

KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K(VCA)beta-4, Maxi K Channel Subunit beta-4, Sl

Sign In for Pricing
View Details