Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAC2 Rabbit Polyclonal Antibody (FITC)

STAC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

24b2, 24b2/STAC2

UniProt

Q6ZMT1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_945344

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUL3 (Cullin-3)
478813 100 µL

CUL3 (Cullin-3)

Sign In for Pricing
View Details
RPN1 Conjugated Antibody
orb1621854 100 µL

RPN1 Conjugated Antibody

Sign In for Pricing
View Details
IL1F6, ID (IL36A, FIL1E, IL1E, IL1F6, Interleukin-36 alpha, FIL1 epsilon, Interleukin-1 epsilon, Interleukin-1 family member 6) (Biotin)
MBS6310016-01 0.2 mL

IL1F6, ID (IL36A, FIL1E, IL1E, IL1F6, Interleukin-36 alpha, FIL1 epsilon, Interleukin-1 epsilon, Interleukin-1 family member 6) (Biotin)

Sign In for Pricing
View Details
IL1F6, ID (IL36A, FIL1E, IL1E, IL1F6, Interleukin-36 alpha, FIL1 epsilon, Interleukin-1 epsilon, Interleukin-1 family member 6) (Biotin)
MBS6310016-02 5x 0.2 mL

IL1F6, ID (IL36A, FIL1E, IL1E, IL1F6, Interleukin-36 alpha, FIL1 epsilon, Interleukin-1 epsilon, Interleukin-1 family member 6) (Biotin)

Sign In for Pricing
View Details
hsa-miR-524-3p miRNA Antagomir
MNH02942 2x 5.0 nmol

hsa-miR-524-3p miRNA Antagomir

Sign In for Pricing
View Details
APOA1, NT (APOA1, Apolipoprotein A-I, Apolipoprotein A1, Truncated apolipoprotein A-I, Apolipoprotein A-I (1-242) ) (MaxLight 550) discontinued
030784-ML550 100 µL

APOA1, NT (APOA1, Apolipoprotein A-I, Apolipoprotein A1, Truncated apolipoprotein A-I, Apolipoprotein A-I (1-242) ) (MaxLight 550) discontinued

Sign In for Pricing
View Details