Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL4 Rabbit Polyclonal Antibody (HRP)

CDKL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5MAI5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKL4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALRE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001009565

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human INHBB Knockout HEK293T cell line
GTR15414301 1 Vial

Human INHBB Knockout HEK293T cell line

Sign In for Pricing
View Details
Lentiviral mouse Pinx1 shRNA (UAS) - Lentiviral mouse Pinx1 shRNA (UAS, RFP) (25)
GTR15292403 1 Vial

Lentiviral mouse Pinx1 shRNA (UAS) - Lentiviral mouse Pinx1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Prl8a4 Protein Vector (Rat) (pPB-C-His)
PV296238 500 ng

Prl8a4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
GUCA2B Peptide
DF9567-BP 1 mg

GUCA2B Peptide

Sign In for Pricing
View Details
Nestin (ESTM46, FLJ21841, Intermediate Filament Protein, Nbla00170, Nes) (APC)
MBS6242289-01 0.1 mL

Nestin (ESTM46, FLJ21841, Intermediate Filament Protein, Nbla00170, Nes) (APC)

Sign In for Pricing
View Details
Nestin (ESTM46, FLJ21841, Intermediate Filament Protein, Nbla00170, Nes) (APC)
MBS6242289-02 5x 0.1 mL

Nestin (ESTM46, FLJ21841, Intermediate Filament Protein, Nbla00170, Nes) (APC)

Sign In for Pricing
View Details