Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1L Rabbit Polyclonal Antibody (HRP)

CD200R1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD200R2, CD200RLa

UniProt

Q6Q8B3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CD200R1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008784

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TOM40-1/2 | Mitochondrial import receptor subunit TOM40-1/2
AS22 4845 50 µg

Anti-TOM40-1/2 | Mitochondrial import receptor subunit TOM40-1/2

Sign In for Pricing
View Details
Psrc1 Mouse Gene Knockout Kit (CRISPR)
KN514142 1 Kit

Psrc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LTB4 (Leukotriene B4) ELISA Kit
E-EL-0061-01 24 Tests

LTB4 (Leukotriene B4) ELISA Kit

Sign In for Pricing
View Details
LTB4 (Leukotriene B4) ELISA Kit
E-EL-0061-02 48 Tests

LTB4 (Leukotriene B4) ELISA Kit

Sign In for Pricing
View Details
LTB4 (Leukotriene B4) ELISA Kit
E-EL-0061-03 96 Tests

LTB4 (Leukotriene B4) ELISA Kit

Sign In for Pricing
View Details
Human MUC5AC (Mucin 5 Subtype AC) ELISA Kit
E-EL-H2279-01 24 Tests

Human MUC5AC (Mucin 5 Subtype AC) ELISA Kit

Sign In for Pricing
View Details