Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFB3 Rabbit Polyclonal Antibody (Biotin)

BPIFB3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RYA3, LPLUNC3, C20orf185

UniProt

P59826

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BPIFB3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_872599

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM195B Rabbit Polyclonal Antibody (PerCP)
orb2511321 100 µL

FAM195B Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit
MBS9399262-01 48 Well

Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit

Sign In for Pricing
View Details
Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit
MBS9399262-02 96 Well

Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit

Sign In for Pricing
View Details
Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit
MBS9399262-03 5x 96 Well

Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit

Sign In for Pricing
View Details
Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit
MBS9399262-04 10x 96 Well

Hamster Sulfotransferase Family Cytosolic 2B Member 1 (SULT2B1) ELISA Kit

Sign In for Pricing
View Details
ICI 118,551 hydrochloride
B1004-10 10 mg

ICI 118,551 hydrochloride

Sign In for Pricing
View Details