Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIDA1 Rabbit Polyclonal Antibody (FITC)

SKIDA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DLN-1, C10orf140

UniProt

E9PAX1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SKIDA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANFPCPPSLIIGRDGDLWPAYSLNTTKDSQTPHKAHPIWKWQLGGSAIPL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)
TRV-0053634-01 20 µL

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)
TRV-0053634-02 100 µL

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)
TRV-0053634-03 200 µL

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)

Sign In for Pricing
View Details
Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)
TRV-0053634-04 1 mL

Polyclonal Antibody to Inhibitory Subunit Of NF Kappa B Zeta (IkBz)

Sign In for Pricing
View Details
Noxa Rabbit mAb
MBS4753140-01 0.1 mL

Noxa Rabbit mAb

Sign In for Pricing
View Details
Noxa Rabbit mAb
MBS4753140-02 5x 0.1 mL

Noxa Rabbit mAb

Sign In for Pricing
View Details