Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIDA1 Rabbit Polyclonal Antibody (HRP)

SKIDA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DLN-1, C10orf140

UniProt

E9PAX1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SKIDA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETNEGTLD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC24A5 Rabbit Polyclonal Antibody
TA367259 100 µL

SLC24A5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASMT (NM_001171038) Human Over-expression Lysate
LC432958 20 µg

ASMT (NM_001171038) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DERPC activation kit by CRISPRa
GA120091 1 Kit

Human DERPC activation kit by CRISPRa

Sign In for Pricing
View Details
LOC400706 Human qPCR Primer Pair (AK096622)
HP222651 200 Reactions

LOC400706 Human qPCR Primer Pair (AK096622)

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF594 conjugate, 0.1mg/mL
BNC941553-500 1x 500 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAK1 pThr212 Rabbit Polyclonal Antibody
AP02438PU-S 50 µL

PAK1 pThr212 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details