Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC103 Rabbit Polyclonal Antibody (FITC)

CCDC103 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SMH, PR46b, CILD17

UniProt

Q8IW40

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC103

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_998772

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPRX AAV siRNA Pooled Vector
18558161 1.0 µg

DPRX AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ZNF25 Polyclonal Antibody, PE-Cy7 Conjugated
bs-4368R-PE-Cy7 100 µL

ZNF25 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Atpbd4 AAV siRNA Pooled Vector
12829166 1.0 µg

Atpbd4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human DCLK3 sgRNA gene knockout kit - Lentiviral human DCLK3 sgRNA gene knockout kit (plasmid)
GTR15388775 1 Vial

Lentiviral human DCLK3 sgRNA gene knockout kit - Lentiviral human DCLK3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rat Anti-mouse CD22/FITC antibody
SLM-30242A-FITC-01 25 Tests

Rat Anti-mouse CD22/FITC antibody

Sign In for Pricing
View Details
Rat Anti-mouse CD22/FITC antibody
SLM-30242A-FITC-02 50 Tests

Rat Anti-mouse CD22/FITC antibody

Sign In for Pricing
View Details