Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD10 Rabbit Polyclonal Antibody (HRP)

ACAD10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6JQN1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAD10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSTA ELISA Kit (Mouse) (OKEH06915)
OKEH06915 96 Well

CSTA ELISA Kit (Mouse) (OKEH06915)

Sign In for Pricing
View Details
Recombinant Human VSTM1 Protein - (Dry Ice)
H00284415-P01-25ug 25 µg

Recombinant Human VSTM1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Ezrin/Radixin Rabbit Polyclonal Antibody (HRP)
orb526348 100 µL

Ezrin/Radixin Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MIRacle™ mmu-miR-7033-5p miRNA Agomir/Antagomir
AM2928 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-7033-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
BMPR1A Rabbit pAb
E2501816 100 µL

BMPR1A Rabbit pAb

Sign In for Pricing
View Details
Mouse SPIN1 siRNA
abx934960-01 15 nmol

Mouse SPIN1 siRNA

Sign In for Pricing
View Details