Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD10 Rabbit Polyclonal Antibody (HRP)

ACAD10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6JQN1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAD10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Defa24 shRNA (UAS) - Lentiviral mouse Defa24 shRNA (UAS) plasmid
GTR15219991 1 Vial

Lentiviral mouse Defa24 shRNA (UAS) - Lentiviral mouse Defa24 shRNA (UAS) plasmid

Sign In for Pricing
View Details
RASGRP2 (NM_001098671) Human Recombinant Protein
PH36540M5 20 µg

RASGRP2 (NM_001098671) Human Recombinant Protein

Sign In for Pricing
View Details
Human DEFb112 ELISA Kit
E011502 1 Each

Human DEFb112 ELISA Kit

Sign In for Pricing
View Details
Melanoma-Associated Antigen F1 (MAGF1) Antibody
abx375445 100 µg

Melanoma-Associated Antigen F1 (MAGF1) Antibody

Sign In for Pricing
View Details
FOLR2 Antibody
MBS9609835-01 0.1 mL

FOLR2 Antibody

Sign In for Pricing
View Details
FOLR2 Antibody
MBS9609835-02 0.2 mL

FOLR2 Antibody

Sign In for Pricing
View Details