Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHPN2 Rabbit Polyclonal Antibody (HRP)

RHPN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RHOBP, P76RBE

UniProt

Q8IUC4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHPN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADLMDLRQACRTPSRDEAGVELLMTYFIQLGFVESRFFPPTRQMGLLFTW

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB41, ID (ZBTB41, FRBZ1, Zinc finger and BTB domain-containing protein 41) (MaxLight 550)
MBS6364651-01 0.1 mL

ZBTB41, ID (ZBTB41, FRBZ1, Zinc finger and BTB domain-containing protein 41) (MaxLight 550)

Sign In for Pricing
View Details
ZBTB41, ID (ZBTB41, FRBZ1, Zinc finger and BTB domain-containing protein 41) (MaxLight 550)
MBS6364651-02 5x 0.1 mL

ZBTB41, ID (ZBTB41, FRBZ1, Zinc finger and BTB domain-containing protein 41) (MaxLight 550)

Sign In for Pricing
View Details
Asmt 3'UTR GFP Stable Cell Line
TU152219 1.0 mL

Asmt 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DCTD polyclonal antibody
BS71940-01 50 µL

DCTD polyclonal antibody

Sign In for Pricing
View Details
DCTD polyclonal antibody
BS71940-02 100 µL

DCTD polyclonal antibody

Sign In for Pricing
View Details
Mouse Antithrombin III ELISA Kit
orb1176687 96 Tests

Mouse Antithrombin III ELISA Kit

Sign In for Pricing
View Details