Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPO Rabbit Polyclonal Antibody (HRP)

MPO Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P05164

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MPO

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000241

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IGF2BP2 Protein, N-His
HV403012-01 50 µg

Recombinant Human IGF2BP2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IGF2BP2 Protein, N-His
HV403012-02 100 µg

Recombinant Human IGF2BP2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IGF2BP2 Protein, N-His
HV403012-03 1 mg

Recombinant Human IGF2BP2 Protein, N-His

Sign In for Pricing
View Details
F10 (NM_007972) Mouse Recombinant Protein
TP507705 20 µg

F10 (NM_007972) Mouse Recombinant Protein

Sign In for Pricing
View Details
MFGE8 CRISPR All-in-one AAV vector set (with saCas9)(Human)
28441151 3x 1.0 µg DNA

MFGE8 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Glyceryl tristearate 80%
G03420 10 g

Glyceryl tristearate 80%

Sign In for Pricing
View Details