Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCS Rabbit Polyclonal Antibody (Biotin)

CCS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC138260

UniProt

O14618

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005116

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFAP4, CT (TFAP4, BHLHC41, Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41) (MaxLight 490)
MBS6354981-01 0.1 mL

TFAP4, CT (TFAP4, BHLHC41, Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41) (MaxLight 490)

Sign In for Pricing
View Details
TFAP4, CT (TFAP4, BHLHC41, Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41) (MaxLight 490)
MBS6354981-02 5x 0.1 mL

TFAP4, CT (TFAP4, BHLHC41, Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41) (MaxLight 490)

Sign In for Pricing
View Details
Chicken Farnesyl Diphosphate Farnesyltransferase 1 ELISA kit
GTR10394992 96 Well

Chicken Farnesyl Diphosphate Farnesyltransferase 1 ELISA kit

Sign In for Pricing
View Details
Genorise® qPCR primers for equine IL-6
GR108035 2 nmol

Genorise® qPCR primers for equine IL-6

Sign In for Pricing
View Details
C22orf29 sgRNA CRISPR Lentivector (Human) (Target 3)
K0346104 1.0 µg DNA

C22orf29 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Chicken Ex-FABP Protein
EXFABP-5-0.05 0.05 mg

Chicken Ex-FABP Protein

Sign In for Pricing
View Details