Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5D Rabbit Polyclonal Antibody (FITC)

INPP5D Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SHIP, SHIP1, SHIP-1, hp51CN, SIP-145, p150Ship

UniProt

Q92835

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

131kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001017915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIC 3'UTR Luciferase Stable Cell Line
TU004436 1.0 mL

CIC 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
USE1 antibody
FNab09296 100 µg

USE1 antibody

Sign In for Pricing
View Details
MIB1 antibody (biotin)
60R-1647 100 ug

MIB1 antibody (biotin)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Sulfoxide reductase heme-binding subunit YedZ (yedZ)
MBS7034297-01 0.02 mg

Recombinant Salmonella enteritidis PT4 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Sulfoxide reductase heme-binding subunit YedZ (yedZ)
MBS7034297-02 0.1 mg

Recombinant Salmonella enteritidis PT4 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Sulfoxide reductase heme-binding subunit YedZ (yedZ)
MBS7034297-03 5x 0.1 mg

Recombinant Salmonella enteritidis PT4 Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Sign In for Pricing
View Details