Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Map2k1 Rabbit Polyclonal Antibody (HRP)

Map2k1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mek1, Prkm, MEKK1, MAPKK1, Prkmk1

UniProt

P31938

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Map2k1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBsAg Polyclonal Antibody, Cy7 Conjugated
bs-1557G-Cy7 100 µL

HBsAg Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Mouse MRC1 siRNA
abx924511-01 15 nmol

Mouse MRC1 siRNA

Sign In for Pricing
View Details
Mouse MRC1 siRNA
abx924511-02 30 nmol

Mouse MRC1 siRNA

Sign In for Pricing
View Details
ELISA Kit For NADH-ubiquinone oxidoreductase chain 5
E2000m 96 Tests

ELISA Kit For NADH-ubiquinone oxidoreductase chain 5

Sign In for Pricing
View Details
INS Recombinant Antibody [1F6] (OACA12610)
OACA12610-100UL 100 µL

INS Recombinant Antibody [1F6] (OACA12610)

Sign In for Pricing
View Details
Rat Sterol carrier protein 2 ELISA kit
GTR10470203 96 Well

Rat Sterol carrier protein 2 ELISA kit

Sign In for Pricing
View Details