Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGM5 Rabbit Polyclonal Antibody (HRP)

PGM5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGMRP

UniProt

Q15124

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PGM5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DASRLIFRLSSSSGVRATLRLYAESYERDPSGHDQEPQAVLSPLIAIALK

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV762439 1.0 µg DNA

GSTM3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Alpha Amylase 1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62188R-BF594 100 µL

Alpha Amylase 1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
HLA-DRB4 CytoSection
TS402743P5 25 Slides

HLA-DRB4 CytoSection

Sign In for Pricing
View Details
EfeO Antibody
orb814088 2 mg

EfeO Antibody

Sign In for Pricing
View Details
Anti-Collagen III/COL3A1 Antibody Picoband® (monoclonal, 9H9), Cy3 Conjugate
M00788-Cy3 100 µg/Vial

Anti-Collagen III/COL3A1 Antibody Picoband® (monoclonal, 9H9), Cy3 Conjugate

Sign In for Pricing
View Details
Mouse Monoclonal NULP1 Antibody (PCRP-TCF25-1F12) [HRP]
NBP3-08354H 100 µL

Mouse Monoclonal NULP1 Antibody (PCRP-TCF25-1F12) [HRP]

Sign In for Pricing
View Details