Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ikzf1 Rabbit Polyclonal Antibody (FITC)

Ikzf1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

I, LyF-, Zfpn, LyF-1, hlk-1, Ikaros, Zfpn1a1, Znfn1a1, mKIAA4227, 5832432G11Rik

UniProt

Q5SWU0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033604

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAR1B Antibody
MBS7132456-01 0.1 mL

SAR1B Antibody

Sign In for Pricing
View Details
SAR1B Antibody
MBS7132456-02 5x 0.1 mL

SAR1B Antibody

Sign In for Pricing
View Details
TrkC, Human (Biotinylated, sf9, His, Avi)
HY-P702700 1 Each

TrkC, Human (Biotinylated, sf9, His, Avi)

Sign In for Pricing
View Details
Anti-CTBP2 Rabbit Monoclonal Antibody, Carrier-free
M02567-2-carrier-free 100 µL

Anti-CTBP2 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Anti-STRADB Antibody Picoband®, iFluor647 Conjugate
A05271-2-iFluor647 100 µg

Anti-STRADB Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Crystallography Sample Support Assembly, Style 1 Mesh mounted on ALS Style (B3S) Base, Box of 20
B-SXM-01-B3S 20 Boxes

Crystallography Sample Support Assembly, Style 1 Mesh mounted on ALS Style (B3S) Base, Box of 20

Sign In for Pricing
View Details