Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ikzf1 Rabbit Polyclonal Antibody (FITC)

Ikzf1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

I, LyF-, Zfpn, LyF-1, hlk-1, Ikaros, Zfpn1a1, Znfn1a1, mKIAA4227, 5832432G11Rik

UniProt

Q5SWU0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033604

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH3 (Notch homolog 3, Drosophila, hN3, CASIL, CADASIL)
N5375-26A 100 µg

NOTCH3 (Notch homolog 3, Drosophila, hN3, CASIL, CADASIL)

Sign In for Pricing
View Details
COVID 19-Nucleoprotein antibody
orb1678442 1 mg

COVID 19-Nucleoprotein antibody

Sign In for Pricing
View Details
Citric Acid Anhydrous AR 99.5%
00821 00500 500 g

Citric Acid Anhydrous AR 99.5%

Sign In for Pricing
View Details
Lentiviral mouse Gkap1 shRNA (UAS) - Lentiviral mouse Gkap1 shRNA (UAS, iRFP) (100)
GTR15180867 1 Vial

Lentiviral mouse Gkap1 shRNA (UAS) - Lentiviral mouse Gkap1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
GOLPH3L Protein Vector (Mouse) (pPB-N-His)
PV185539 500 ng

GOLPH3L Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
APOC3 3'UTR Luciferase Stable Cell Line
TU000972 1x106 cells / 1.0 mL

APOC3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details