Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhh Rabbit Polyclonal Antibody (Biotin)

Dhh Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C78960

UniProt

Q61488

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dhh

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Methyltransferase 1 (DNMT, MCMT, M.Hsa1, DNA (cytosine-5-) -methyltransferase 1, DNA MTase Mmu1, M.HsaI)
D3931-61A3 100 µg

DNA Methyltransferase 1 (DNMT, MCMT, M.Hsa1, DNA (cytosine-5-) -methyltransferase 1, DNA MTase Mmu1, M.HsaI)

Sign In for Pricing
View Details
mmu-miR-1231-3p miRNA Antagomir
MBS8319615-01 10 nmol

mmu-miR-1231-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-1231-3p miRNA Antagomir
MBS8319615-02 20 nmol

mmu-miR-1231-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-1231-3p miRNA Antagomir
MBS8319615-03 5x 20 nmol

mmu-miR-1231-3p miRNA Antagomir

Sign In for Pricing
View Details
Calcitonin Gene Related Peptide (CGRP, Calcitonin Gene-related Peptide 1, CGRP1, Calcitonin Gene-related Peptide I, CGRP I, CGRP-I, Alpha Type CGRP, CAL6, Cal1, Calc, Calcitonin 1, CALC 1, CALC 2, RATCAL6, Calcitonin-related Polypeptide alpha, CALC A, CALCA) (PE)
C0115-01D-PE 100 µL

Calcitonin Gene Related Peptide (CGRP, Calcitonin Gene-related Peptide 1, CGRP1, Calcitonin Gene-related Peptide I, CGRP I, CGRP-I, Alpha Type CGRP, CAL6, Cal1, Calc, Calcitonin 1, CALC 1, CALC 2, RATCAL6, Calcitonin-related Polypeptide alpha, CALC A, CALCA) (PE)

Sign In for Pricing
View Details
TNF Protein Vector (Rat) (pPM-C-HA)
PV312036 500 ng

TNF Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details