Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAP3 Rabbit Polyclonal Antibody (HRP)

DAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DAP-3, S29mt, MRPS29, MRP-S29, bMRP-10

UniProt

P51398

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIPILVSNYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004623

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C3a (C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, C3, Complement C3 alpha Chain, CPAMD1) (MaxLight 650)
MBS6400171-01 0.1 mL

Complement C3a (C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, C3, Complement C3 alpha Chain, CPAMD1) (MaxLight 650)

Sign In for Pricing
View Details
Complement C3a (C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, C3, Complement C3 alpha Chain, CPAMD1) (MaxLight 650)
MBS6400171-02 5x 0.1 mL

Complement C3a (C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, C3, Complement C3 alpha Chain, CPAMD1) (MaxLight 650)

Sign In for Pricing
View Details
Anti-USP10 Polyclonal Antibody
TMAB-14009-01 50 μL

Anti-USP10 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-USP10 Polyclonal Antibody
TMAB-14009-02 100 µL

Anti-USP10 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-USP10 Polyclonal Antibody
TMAB-14009-03 200 µL

Anti-USP10 Polyclonal Antibody

Sign In for Pricing
View Details
CD23 Mouse Monoclonal Antibody
TD-P20374 100 µL

CD23 Mouse Monoclonal Antibody

Sign In for Pricing
View Details