Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAP3 Rabbit Polyclonal Antibody (HRP)

DAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DAP-3, S29mt, MRPS29, MRP-S29, bMRP-10

UniProt

P51398

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIPILVSNYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004623

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS27 (MPN, Serine Protease 27, Marapsin, Pancreasin) (MaxLight 550)
131909-ML550 100 µL

PRSS27 (MPN, Serine Protease 27, Marapsin, Pancreasin) (MaxLight 550)

Sign In for Pricing
View Details
MCM4 Antibody
MBS9607797-01 0.1 mL

MCM4 Antibody

Sign In for Pricing
View Details
MCM4 Antibody
MBS9607797-02 0.2 mL

MCM4 Antibody

Sign In for Pricing
View Details
MCM4 Antibody
MBS9607797-03 5x 0.2 mL

MCM4 Antibody

Sign In for Pricing
View Details
Human p-AKT (p-AKT) ELISA Kit
YP-W11012-01 48 Tests

Human p-AKT (p-AKT) ELISA Kit

Sign In for Pricing
View Details
Human p-AKT (p-AKT) ELISA Kit
YP-W11012-02 96 Tests

Human p-AKT (p-AKT) ELISA Kit

Sign In for Pricing
View Details