Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGEF2 Rabbit Polyclonal Antibody (HRP)

ARFGEF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BIG2, PVNH2, dJ1164I10.1

UniProt

Q9Y6D5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARFGEF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006411.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pde8b Pre-designed siRNA Set A
SI110301A 1 Each

Mouse Pde8b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Activin receptor type-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-12415R-BF488 100 µL

Activin receptor type-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
QuantiChrom™ BCP Albumin Assay Kit
DIAP-250 250 Tests

QuantiChrom™ BCP Albumin Assay Kit

Sign In for Pricing
View Details
Mouse Monoclonal Anti-Human IgG-Biotin Conjugate
10119M-BTN 0.5 mL

Mouse Monoclonal Anti-Human IgG-Biotin Conjugate

Sign In for Pricing
View Details
hsa-miR-4530 miRNA Antagomir
MBS8317301-01 10 nmol

hsa-miR-4530 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4530 miRNA Antagomir
MBS8317301-02 20 nmol

hsa-miR-4530 miRNA Antagomir

Sign In for Pricing
View Details