Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGEF2 Rabbit Polyclonal Antibody (HRP)

ARFGEF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BIG2, PVNH2, dJ1164I10.1

UniProt

Q9Y6D5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARFGEF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006411.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSTR1 (SSTR1, SRIF-2, SS1R) discontinued
226041-01 50 µL

SSTR1 (SSTR1, SRIF-2, SS1R) discontinued

Sign In for Pricing
View Details
SSTR1 (SSTR1, SRIF-2, SS1R) discontinued
226041-02 100 µL

SSTR1 (SSTR1, SRIF-2, SS1R) discontinued

Sign In for Pricing
View Details
EXOSC10 antibody
FNab02900 100 µg

EXOSC10 antibody

Sign In for Pricing
View Details
Recombinant Human Interleukin-11, Pichia
7-00931 2 µg

Recombinant Human Interleukin-11, Pichia

Sign In for Pricing
View Details
Rabbit anti-human coiled-coil domain containing 44 polyclonal Antibody
MBS712997-01 0.1 mL

Rabbit anti-human coiled-coil domain containing 44 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human coiled-coil domain containing 44 polyclonal Antibody
MBS712997-02 5x 0.1 mL

Rabbit anti-human coiled-coil domain containing 44 polyclonal Antibody

Sign In for Pricing
View Details