Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1L1 Rabbit Polyclonal Antibody (FITC)

TOM1L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sr, C80573, Srcasm, 2310045L10Rik

UniProt

Q923U0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of mouse TOM1L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: INTTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_006534331.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HHBrk1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-5124R-PE-Cy5 100 µL

HHBrk1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
RNU6-1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1849008 1.0 µg DNA

RNU6-1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Erlin2 (NM_153592) Mouse Tagged ORF Clone Lentiviral Particle
MR205094L3V 200 µL

Erlin2 (NM_153592) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Car3 Mouse qPCR Primer Pair (NM_007606)
MP201711 200 Reactions

Car3 Mouse qPCR Primer Pair (NM_007606)

Sign In for Pricing
View Details
Ms Van Der Salm Basal Salt Mixture With Vitamins
M5642-10L 10 L

Ms Van Der Salm Basal Salt Mixture With Vitamins

Sign In for Pricing
View Details
Ceacam13 (NM_028171) Mouse Tagged ORF Clone
MR215012 10 µg

Ceacam13 (NM_028171) Mouse Tagged ORF Clone

Sign In for Pricing
View Details