Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRB3 Rabbit Polyclonal Antibody (HRP)

MSRB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DFNB74

UniProt

Q8IXL7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_932346

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Anti-Sm28/Smp28/GST28/GST-mu protein (S. Japonicum) IgG-Biotin conj
SM283-BTN 100 µL

Monoclonal Anti-Sm28/Smp28/GST28/GST-mu protein (S. Japonicum) IgG-Biotin conj

Sign In for Pricing
View Details
Cadherin 5 (CDH5) Antibody (FITC)
abx274472-01 200 µL

Cadherin 5 (CDH5) Antibody (FITC)

Sign In for Pricing
View Details
Cadherin 5 (CDH5) Antibody (FITC)
abx274472-02 1 mL

Cadherin 5 (CDH5) Antibody (FITC)

Sign In for Pricing
View Details
Lentiviral human FAM193B sgRNA gene knockout kit - Lentiviral human FAM193B sgRNA gene knockout kit (100)
GTR15397477 1 Vial

Lentiviral human FAM193B sgRNA gene knockout kit - Lentiviral human FAM193B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
RPS3AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV781925 1.0 µg DNA

RPS3AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rat Bone Marrow Stromal Stem Cells
RPC-892 5x 10^5

Rat Bone Marrow Stromal Stem Cells

Sign In for Pricing
View Details