Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRB3 Rabbit Polyclonal Antibody (HRP)

MSRB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DFNB74

UniProt

Q8IXL7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_932346

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H15 Protein Lysate (Human) with C-Ha Tag
50743031 100 µg

ZC3H15 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
THOC1 Antibody - C-terminal region
ARP40577_P050-25UL 25 µL

THOC1 Antibody - C-terminal region

Sign In for Pricing
View Details
Lentiviral human H4C7 shRNA (UAS) - Lentiviral human H4C7 shRNA (UAS, RFP) (25)
GTR15352742 1 Vial

Lentiviral human H4C7 shRNA (UAS) - Lentiviral human H4C7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PSG1 protein (His tag)
80R-3815 0.1 mg

PSG1 protein (His tag)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_30532 Polyclonal Antibody
MBS9017290 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_30532 Polyclonal Antibody

Sign In for Pricing
View Details
HEAB (CLP1) (NM_006831) Human Recombinant Protein
TP301772 20 µg

HEAB (CLP1) (NM_006831) Human Recombinant Protein

Sign In for Pricing
View Details