Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRK1 Rabbit Polyclonal Antibody (HRP)

LRRK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIPK6, Roco1

UniProt

Q38SD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALMFLRLQGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

144kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078928

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Porcine Aminopeptidase N (ANPEP) Monoclonal Antibody
VD11N961 1 Each

Mouse Anti-Porcine Aminopeptidase N (ANPEP) Monoclonal Antibody

Sign In for Pricing
View Details
PGAM5 Polyclonal Antibody
MBS9432824-01 0.05 mL

PGAM5 Polyclonal Antibody

Sign In for Pricing
View Details
PGAM5 Polyclonal Antibody
MBS9432824-02 0.1 mL

PGAM5 Polyclonal Antibody

Sign In for Pricing
View Details
PGAM5 Polyclonal Antibody
MBS9432824-03 5x 0.1 mL

PGAM5 Polyclonal Antibody

Sign In for Pricing
View Details
Breakpoint Cluster Region Protein Uterine Leiomyoma 1 Barrier To Autointegration Factor (BCRP1) (BANF1) Rabbit anti-Human Pol
GWB-611B1A 0.05 mg

Breakpoint Cluster Region Protein Uterine Leiomyoma 1 Barrier To Autointegration Factor (BCRP1) (BANF1) Rabbit anti-Human Pol

Sign In for Pricing
View Details
SEO1 Antibody
orb851143 2 mg

SEO1 Antibody

Sign In for Pricing
View Details