Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX101 Rabbit Polyclonal Antibody (FITC)

TEX101 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SGRG, CT131, GTPR867, NYD-SP8, PRO1884, SPATA44, TES101RP

UniProt

Q9BY14

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TEX101

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_113639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCAN2 antibody
70R-9145 100 µL

RCAN2 antibody

Sign In for Pricing
View Details
Scutellarin discontinued
371957 5 mg

Scutellarin discontinued

Sign In for Pricing
View Details
FBXW7 (F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, AGO, CDC4, DKFZp686F23254, F-box Protein FBX30, FBX30, FBXO30, F-box Protein SEL-10, FBW6, FBXW6, FLJ16457, hAgo, hCdc4, Homolog of C. elegans SEL 10, SEL10, SEL-10) (MaxLight 490)
126716-ML490 100 µL

FBXW7 (F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, AGO, CDC4, DKFZp686F23254, F-box Protein FBX30, FBX30, FBXO30, F-box Protein SEL-10, FBW6, FBXW6, FLJ16457, hAgo, hCdc4, Homolog of C. elegans SEL 10, SEL10, SEL-10) (MaxLight 490)

Sign In for Pricing
View Details
MLLT3 antibody
70R-18533 50 μL

MLLT3 antibody

Sign In for Pricing
View Details
(S) -2- ((2-Hydroxy-1-phenylethyl) amino) acetic acid
ZLB01202-01 250 mg

(S) -2- ((2-Hydroxy-1-phenylethyl) amino) acetic acid

Sign In for Pricing
View Details
(S) -2- ((2-Hydroxy-1-phenylethyl) amino) acetic acid
ZLB01202-02 500 mg

(S) -2- ((2-Hydroxy-1-phenylethyl) amino) acetic acid

Sign In for Pricing
View Details