Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOOK1 Rabbit Polyclonal Antibody (Biotin)

HOOK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HK1

UniProt

Q9UJC3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REVFIRLQHENKMLRLQQEGSENERIEELQEQLEQKHRKMNELETEQRLS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHISA4 (NM_198149) Human Over-expression Lysate
LS149345 100 µg

SHISA4 (NM_198149) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human SFT2D1 shRNA (UAS) - Lentiviral human SFT2D1 shRNA (UAS, RFP) plasmid
GTR15119965 1 Vial

Lentiviral human SFT2D1 shRNA (UAS) - Lentiviral human SFT2D1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1295361-01 0.02 mg (E-Coli)

Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1295361-02 0.02 mg (Yeast)

Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1295361-03 0.1 mg (E-Coli)

Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1295361-04 0.1 mg (Yeast)

Recombinant Cupriavidus pinatubonensis Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details