Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNB Rabbit Polyclonal Antibody (HRP)

PITPNB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VIB1B, PtdInsTP, PI-TP-beta

UniProt

B7Z7Q0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PITPNB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001271206.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cbl-b (G-1) HRP
sc-8006 HRP 200 µg/mL

Cbl-b (G-1) HRP

Sign In for Pricing
View Details
C15orf40 Mouse Monoclonal Antibody [Clone ID: LBI1D8]
AMM10173V 100 µL

C15orf40 Mouse Monoclonal Antibody [Clone ID: LBI1D8]

Sign In for Pricing
View Details
IL23R (Interleukin 23 Receptor) (MaxLight 650)
MBS6228248-01 0.1 mL

IL23R (Interleukin 23 Receptor) (MaxLight 650)

Sign In for Pricing
View Details
IL23R (Interleukin 23 Receptor) (MaxLight 650)
MBS6228248-02 5x 0.1 mL

IL23R (Interleukin 23 Receptor) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Cell division protein ZapA (zapA)
MBS1289686-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi Cell division protein ZapA (zapA)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Cell division protein ZapA (zapA)
MBS1289686-02 0.1 mg (E-Coli)

Recombinant Salmonella typhi Cell division protein ZapA (zapA)

Sign In for Pricing
View Details