Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR6 Rabbit Polyclonal Antibody (FITC)

MTMR6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9Y217

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KDLESKIKQRKNKQTDGILTKELLHSVHPESPNLKTSLCFKEQTLLPVND

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004676

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Albumin BioAssayTM Kit (With Standard, Methyl Bromide Green Method) discontinued
405742 1 Kit

Albumin BioAssayTM Kit (With Standard, Methyl Bromide Green Method) discontinued

Sign In for Pricing
View Details
Porcine PACAP-27 (Pituitary Adenylate Cyclase Activating Polypeptide 27) ValidElisa Kit
EK345156 96 Well

Porcine PACAP-27 (Pituitary Adenylate Cyclase Activating Polypeptide 27) ValidElisa Kit

Sign In for Pricing
View Details
GALNT4 (Polypeptide N-acetylgalactosaminyltransferase 4, Polypeptide GalNAc Transferase 4, GalNAc-T4, pp-GaNTase 4, Protein-UDP Acetylgalactosaminyltransferase 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4) (Biotin)
127139-Biotin 100 µL

GALNT4 (Polypeptide N-acetylgalactosaminyltransferase 4, Polypeptide GalNAc Transferase 4, GalNAc-T4, pp-GaNTase 4, Protein-UDP Acetylgalactosaminyltransferase 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4) (Biotin)

Sign In for Pricing
View Details
AAT Polyclonal Antibody
MBS9419711-01 0.05 mL

AAT Polyclonal Antibody

Sign In for Pricing
View Details
AAT Polyclonal Antibody
MBS9419711-02 0.1 mL

AAT Polyclonal Antibody

Sign In for Pricing
View Details
AAT Polyclonal Antibody
MBS9419711-03 5x 0.1 mL

AAT Polyclonal Antibody

Sign In for Pricing
View Details